Protein Info for H281DRAFT_00814 in Paraburkholderia bryophila 376MFSha3.1

Annotation: molybdopterin synthase subunit MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 5 to 119 (115 residues), 132 bits, E=5.7e-43

Best Hits

Swiss-Prot: 68% identical to MOAE_RALSO: Molybdopterin synthase catalytic subunit (moaE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 94% identity to bug:BC1001_1825)

MetaCyc: 55% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A0A2Z5MAN8 at UniProt or InterPro

Protein Sequence (158 amino acids)

>H281DRAFT_00814 molybdopterin synthase subunit MoaE (Paraburkholderia bryophila 376MFSha3.1)
MPVRVQTEDFDLSAEVAALRARNPKIGAVACFVGTVRDLNEGSAVEAMELEHYPGMTEKS
LEAIVESARLRWPGIEVLIVHRVGKLYPLDQIVLVATTAAHRGDAFASCEFVMDYLKTQA
PFWKKEKTEAGERWVDARVTDDTALARWGIESGNGSSE