Protein Info for H281DRAFT_00807 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 4-amino-4-deoxy-L-arabinose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 175 to 205 (31 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details PF02366: PMT" amino acids 15 to 245 (231 residues), 51.9 bits, see alignment E=1.2e-17 PF13231: PMT_2" amino acids 69 to 231 (163 residues), 54.1 bits, see alignment E=3.4e-18 PF18583: Arnt_C" amino acids 453 to 557 (105 residues), 137.7 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_1834)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAW9 at UniProt or InterPro

Protein Sequence (573 amino acids)

>H281DRAFT_00807 4-amino-4-deoxy-L-arabinose transferase (Paraburkholderia bryophila 376MFSha3.1)
MNDTPSRLPLNRTAILLLVLALAVIWFVPLGWRHLLPSDEGRYAEMAREMFVTGDWITPR
YNGYKYFEKPPLQTWANALTFAWFGIGEWQARLYTALTGFAGVLLIGFTGARVFNAATGV
FAALVLATSPYWNLMGHFNTLDMGLSFWMELTLCALLLAQRPNLETARVRGWMWLCWGSM
ALAVLSKGLVGVILPGAVLVIYTLVARDWAVWKRLHLIGGLIVFFAIVTPWFVLVQQRNP
EFLNFFFIVQQFKRYLTPEQNRPGPFYYFVPVLIVGFLPWLSVVLQSVRHAWRLPRQPNG
FAPVTMMLVWTGFIFLFFSASHSKLLSYTLPIAPPIALLIGMYLPLVTRDQWRRHLAGYA
LFLVVAAFVALFLPRFGSQRNPAELYAQYRTWVLAALAVAFVLTLAALWFNRRSRAGSLG
TIASFGAAWLLLGTIAGIGHDVFGRLSSGAPLAPAIKAQMAKLPADTPFYSVGVLDHTLP
FYIGHTMTMVEHPDELAFGVSVEPQKWLPSVEAWVERWKADRYALALIPPSTYKRLLKEG
LPMQVVAQDSRRVVVMKPLAAGAVAAPVEKTQQ