Protein Info for H281DRAFT_00801 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF01522: Polysacc_deac_1" amino acids 16 to 168 (153 residues), 29.5 bits, see alignment E=3.2e-11

Best Hits

Swiss-Prot: 37% identical to ARND_AERS4: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Aeromonas salmonicida (strain A449)

KEGG orthology group: None (inferred from 93% identity to bxe:Bxe_A2390)

Predicted SEED Role

"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>H281DRAFT_00801 Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family (Paraburkholderia bryophila 376MFSha3.1)
LARIVLKIDVDTLRGTREGVPNLARIFDRFKARATFLFSLGPDHTGWAMRRVLRPGFLQK
VSRTSVVEHYGLKQLMYGVLLPGPDIGAKASAEMRAIHEAGFECGIHTWDHVYWQDNVRS
KDRAWTSAQMQKSRDRFIEIFGAPPVTHGAAGWQMNGHAFEQIDAWGMHYASDGRGHSPY
FPVVDGRTLAHVQMPTTLPTLDEVLGVDGVDEHNVAAFMLKHTENNPHDQVFTLHAELEG
QKLAPNFEQLLEGWRAQGHTFATMGDYYATLDRGALPSYPVTWGEIPGRSGELIVQP