Protein Info for H281DRAFT_00795 in Paraburkholderia bryophila 376MFSha3.1

Annotation: inorganic phosphate transporter, PiT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details PF01384: PHO4" amino acids 25 to 325 (301 residues), 318.5 bits, see alignment E=2.5e-99

Best Hits

Swiss-Prot: 63% identical to PIT_RHIME: Probable low-affinity inorganic phosphate transporter (pit) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 96% identity to bxe:Bxe_A2395)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAV9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>H281DRAFT_00795 inorganic phosphate transporter, PiT family (Paraburkholderia bryophila 376MFSha3.1)
MQSIQLAIWVVAGLVAVALIFDFMNGFHDAANSIATVVSTGVLKPQQAVAFAAAFNVVAY
FVFHLKVAATVGKGTIDPGIVDHYVIFGALVGAIGWNVITWHYGIPSSSSHALIGGLVGS
ALAKSGWGSLNFDGLLKTVAFIFISPLLGFVLGSFFMLAVSWIYFRTPPSKVDRRFRRLQ
LVSAGLYSLGHGGNDAQKTIGIIWMLLIATGYASSIAEAPPLWVIGGCYLSMGVGTLFGG
WRIVRTMGQKITKLKPVGGFCAESGGAITLFTASWLGIPVSTTHTITGAIVGVGATQKLS
AVRWGVAGNIVWAWILTIPASAALAAAAWWFGHHFL