Protein Info for H281DRAFT_00780 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sulfate transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 40 to 67 (28 residues), see Phobius details amino acids 87 to 114 (28 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 41 to 298 (258 residues), 412 bits, see alignment E=1e-127 TIGR00969: sulfate ABC transporter, permease protein" amino acids 42 to 294 (253 residues), 326.8 bits, see alignment E=1.1e-101 PF00528: BPD_transp_1" amino acids 107 to 296 (190 residues), 50.9 bits, see alignment E=7.9e-18

Best Hits

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 89% identity to bug:BC1001_1863)

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHU8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>H281DRAFT_00780 sulfate transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSRHSAGHVDNADGVTPHAVAPRAPLNIARRPDPVTEPPLVRWILTGIALLFLGLFLVVP
LVAVFYQALNKGLGFYLESLADPDALAAIKLTAITAGIAVPLNLVFGLAASWCIAKFEFR
GKALLTTLIDLPFSVSPVISGLIYVLMFGAQGWFGPWLQAHNVQIIFAVPGIVLATIFVT
FPFVARELIPLMQAQGNDEEEAAHVLGASGWQIFRRVTLPNVKWGLLYGVILCNARAMGE
FGAVSVVSGHIRGQTDTMPLHVEILYNEYNFSAAFAVASVLALLALVTLALKLLAERHMS
AELSDARDVPAHAGPVTLPSALPSTAQSLNMQSSQQHPLKQGEL