Protein Info for H281DRAFT_00760 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sulfonate transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 86 to 217 (132 residues), 100.7 bits, E=5.7e-33

Best Hits

Swiss-Prot: 81% identical to SSUB1_PARXL: Aliphatic sulfonates import ATP-binding protein SsuB 1 (ssuB1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 82% identity to bpy:Bphyt_1746)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Protein Sequence (334 amino acids)

>H281DRAFT_00760 sulfonate transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MSATTFSSSFGGIAGSDLEAELAQARIADRDAGLAADSQQRDTAHGYVRDASAAGEPNGP
RRENNAVDYSVRLRGVGKQYGERKVLTDFDLSIERGSFVAIVGRSGCGKSTLLRLVAGLE
KTTAGVLEKRAEDGRPLDTRIMFQDARLLPWKSVLQNVMLGLPRSAREDARAVLAEVGLL
ERAGDWPAQLSGGQRQRVALARALVHRPQLLLLDEPLGALDALTRIEMHSLIERLWREHK
FTALLVTHDVHEAVALGDRILLIEEGRIALDQPVPLARPRARASAGFAALEEHVLQRVLK
NAPSDDALSGQPEDARGTRSQGRFRRPTDVRWAV