Protein Info for H281DRAFT_00729 in Paraburkholderia bryophila 376MFSha3.1

Annotation: O-antigen ligase like membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 49 to 66 (18 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 288 to 319 (32 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details amino acids 479 to 498 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 295 to 432 (138 residues), 31.8 bits, see alignment E=6e-12

Best Hits

KEGG orthology group: None (inferred from 88% identity to bug:BC1001_1915)

Predicted SEED Role

"FIG00460920: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>H281DRAFT_00729 O-antigen ligase like membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MERLLITPSSARLALRTPADDRQGATTRSERGAARATRTRRASRTLRHPLRWPLLLFGAT
LGLILLHQGKVVELFFPAGAFGVALLLYRRSPAHYLGFVCWLFFLTPEVRRLADFVSGAF
NQQSPIMVAPLLAVALMGFTLIKHVSAFGQRRAAPLLLIVIALLYAYVVGFVQAGPAAAT
FTLINWLYPVMVAFYMTVTWRHYPDYHRVLLKTFVFGGLLMSLYGLLEFISPMPWDAFWL
IASKMESEGQPVPFGMRISSTMNSCGPFAVTLMTILLMSLAARGKARIVLGCVGIPALLL
TSARSTWGGFAIALVYSFAMLDGKSRMRLLAGVFGLAVMAAPLMMIDQVAEPVMRRFSTI
QDIGEDNSYQARAEFYKTFLSSALTDIAGQGLGATGQGTKLSDDKSASAIADFDSGLMEV
PFVMGWPGTLLYATGVLMLLWRAYRASRSHPTDLLAISGVGVAVAIFSMMIFINTLTSVS
GMFFFLGVTLPVISLRYARERHATNSATVSRT