Protein Info for H281DRAFT_00712 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNAse R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 TIGR02063: ribonuclease R" amino acids 19 to 749 (731 residues), 828.9 bits, see alignment E=3.6e-253 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 75 to 749 (675 residues), 700.2 bits, see alignment E=2.5e-214 PF08206: OB_RNB" amino acids 86 to 143 (58 residues), 81.6 bits, see alignment 5.2e-27 PF17876: CSD2" amino acids 164 to 236 (73 residues), 85.2 bits, see alignment E=5.3e-28 PF00773: RNB" amino acids 258 to 589 (332 residues), 360.4 bits, see alignment E=2e-111 PF00575: S1" amino acids 665 to 746 (82 residues), 39.8 bits, see alignment E=9.6e-14

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 95% identity to bpy:Bphyt_1707)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAP5 at UniProt or InterPro

Protein Sequence (833 amino acids)

>H281DRAFT_00712 RNAse R (Paraburkholderia bryophila 376MFSha3.1)
MQREKIIDKPLSKFPYPIPSREEILGVLRTSEAPLAANDIAEALSIKRQEREGFFKRLGA
MERDGQIRLDQRNLYQLTHPSNFVAGRVQGHRDGYGFLIRDDGQDDLFLPTAEMQKVMHN
DRVLARIVGYDRRGRPEGHIVEVTDRANKRVIGRLLNENGALIVAPEDKRIGHDILITQN
TKKAKVGQVVVVELTDFPSRHSQPLGRVAEVLGDIDDPGMEIEIAVRKYGVPHEFSPDAL
AEASKLPDEVRPADVRHRVDLRDVPLVTIDGEDARDFDDAVYCEPVKVGRGDGFRLIVAI
ADVSHYVHPKSGLDADAIERSTSVYFPRRVIPMLPEKLSNGLCSLNPSVDRCVLVCDMIV
TARGEVKAYQFYPGVMHSAARLTYTEVAAVLKNTKGPEAARRAALLPQLQNLYGVYKSLF
AARQKRGAIDFDTTETYIVCNAQGKIEQIVPRTRNDAHKLIEECMLAANVCAADFLKRNK
HPGLFRVHAGPTAEKLENLRTFLRGMGLTLGGGDKPHASDYAALMAQIRERPDAQMLQTM
LLRSMQQAVYSPDNIGHFGLAYEAYAHFTSPIRRYPDLLTHRAIYAILQGRKYQPEPPQG
VTLNTALSPRARAMQQADEEKSGRSRSNNVAIWEELGLHCSANERRADEASRDVEAWLKC
YFMRDKLGEEYGGMVNGVTSFGIFVQLDSLFIEGLVHVTELGSDYFQYDEIKNELRGERT
GIRYRLSDRVRVQVSRVDLDARKIDFRLVRDTPIKPHPVRGAAAADKSSGENGGARVRAL
PPVEGGNAAGARRKKAAPAQSAAVKEARAARGAAKKHGAAPKPASKPTARKKR