Protein Info for H281DRAFT_00655 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 126.4 bits, see alignment E=1.3e-40 PF08402: TOBE_2" amino acids 286 to 357 (72 residues), 47.1 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_1337)

MetaCyc: 41% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>H281DRAFT_00655 putative spermidine/putrescine transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MSSKLEAIGIAKRYGDAVALEPTDLAVQAGEFLTLLGPSGSGKTTLLQMISGLVAPSAGR
IEIDGRDVTHVEPGKRGIGMVFQSYALFPHMSVWDNVAYGLRMRRKSRDEVRGAVDDALA
MVRMTEYAKRFPKELSGGQQQRIALARCFAYRPSVILLDEPLGALDKKLREHMQSEIRRL
HKELGATFVYVTHDQDEALTLSDRICLMNQARIEQVGTPADLYDRPATRFAAGFIGHSNL
LEGALDDTRGASGEAILLAAGGRIPLPMNAMNASVASGAAGTRHTLLVRPEAPRLVEPER
GFVDGTIADIVFFGSDTRVQLAMNDGSELTVRCERSLSPRIGDKVGLVWDPYRTTLLQA