Protein Info for H281DRAFT_00648 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized conserved protein YgbK, DUF1537 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF07005: SBD_N" amino acids 3 to 222 (220 residues), 181 bits, see alignment E=3e-57 PF17042: NBD_C" amino acids 252 to 407 (156 residues), 83.7 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: None (inferred from 81% identity to bgf:BC1003_0577)

Predicted SEED Role

"Domain of unknown function DUF1537"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>H281DRAFT_00648 Uncharacterized conserved protein YgbK, DUF1537 family (Paraburkholderia bryophila 376MFSha3.1)
MSILIIADDLSGAADCAIGFASAGHRTIVTLDVPAHGLDAQAADVIAADTDTRRLTPAQA
AQRSAAAWQTLRGPGRRLYKKIDSTLRGNWAAEVAALQPLAGLAIVAPAFPATGRTLRGG
RVFVHGEPLESTDTWQLDNPGRAADLHAMLAEAGLSTAQLEVDALREGADTLAAQIAAVT
ASGTQALVVDAETRQDLATLAQVTTQMSEALFWVGSGGLAREIAGLAGLFDARPAAQTQC
PPQSRDENAPVLILVGSLSAVSERQCAMLRERAGMAELTVPPAMLRDGERHPDWPAWRAR
IGEVIATRADLLLRIGRDDAFDPAEGALLSTALAALVEPHFNALGGLIATGGETARAMLS
AVGVSGVELIAEIEPGVAIGKPVEARASQPHLRIVTKAGAFGTDHALFAAWRYLHEAPAT
SAVAGTGSHAPA