Protein Info for H281DRAFT_00637 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 199 (195 residues), 249.4 bits, E=1.7e-78
• PF00117: GATase
  • amino acids 6 to 195 (190 residues), 138 bits, E=7.7e-44
• PF07722: Peptidase_C26
  • amino acids 68 to 178 (111 residues), 38.7 bits, E=2.5e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 208 to 527 (320 residues), 480.8 bits, E=1.8e-148
• PF02540: NAD_synthase
  • amino acids 215 to 289 (75 residues), 33.7 bits, E=5.3e-12
• PF03054: tRNA_Me_trans
  • amino acids 224 to 257 (34 residues), 22.7 bits, see alignment (E = 1.7e-08)
• PF00958: GMP_synt_C
  • amino acids 440 to 526 (87 residues), 140.3 bits, E=4.2e-45

Best Hits

Swiss-Prot: 98% identical to GUAA_PARXL: GMP synthase [glutamine-hydrolyzing] (guaA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to bxe:Bxe_A1708)

MetaCyc: 66% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A2Z5M9N3 at UniProt or InterPro

Protein Sequence (527 amino acids)

>H281DRAFT_00637 GMP synthase (glutamine-hydrolyzing) (Paraburkholderia bryophila 376MFSha3.1)
MHDKILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTE
TDTPRVPQAVFELGVPVLGICYGMQAMAEQLGGKVDIGHLREFGYAEVRARNHTSLLEGI
SDFTTPEGHGMLKVWMSHGDKVLEMPPGFALMASTESCPIAAMADETRRFYGLQWHPEVT
HTLQGRAMLERFVLQICGARPDWEMGHYIDEAVAKIREQVGNEHVILGLSGGVDSSVAAA
LLHRAIGDQLTCVFVDHGLLRLNEAEQVMATFADHLGVKVIHVDASDVFLRKMEGVTDPE
AKRKIIGAEFVEVFQTEAGKLTDAKWLAQGTIYPDVIESAGKGKKATQTIKSHHNVGGLP
ETLNLKLLEPLRELFKDEVRELGVKLGLPPAMVYRHPFPGPGLGVRILGEVKRDFADLLR
RADAIFIETLRTFIDKETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTL
DFMTAHWAHLPHELLGHVSNRIINEVRGINRVVYDISGKPPATIEWE