Protein Info for H281DRAFT_00615 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 272 (270 residues), 204.7 bits, see alignment E=1.3e-64

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 97% identity to bug:BC1001_2159)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBL1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>H281DRAFT_00615 phosphatidate cytidylyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MLKTRVITAVVLLAVFLPVTLFAPVGAFGALIAFVVVFAAWEWARLLKLGGAGPVIYALV
AAVALVASTRLGIGVDDARPFYKAAAIFWVIAGPFVLLRKPTLAQGAWRNFLFLAGIVIF
VACWHALVAARMQGVPFVLSLLLLVWLADIGAYFSGKAFGKHKLAPAISPGKTWEGAIGG
WLVVMIVALAAVVLHAFEPTLYSGLWAHWGAPRALLALTLLVVFSVVGDLFESMMKRQAG
VKDSSGLLPGHGGVLDRIDALLPVLPLAMLLLG