Protein Info for H281DRAFT_00610 in Paraburkholderia bryophila 376MFSha3.1

Annotation: SSU ribosomal protein S2P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR01011: ribosomal protein uS2" amino acids 3 to 225 (223 residues), 323.6 bits, see alignment E=2.5e-101 PF00318: Ribosomal_S2" amino acids 8 to 223 (216 residues), 311.6 bits, see alignment E=1.1e-97

Best Hits

Swiss-Prot: 98% identical to RS2_PARXL: 30S ribosomal protein S2 (rpsB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 98% identity to bge:BC1002_1773)

MetaCyc: 59% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAG0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>H281DRAFT_00610 SSU ribosomal protein S2P (Paraburkholderia bryophila 376MFSha3.1)
MAVTMRQMLEAGVHFGHQTRFWNPKMAPFIFGHRNKIHIINLEKTLPMYNDALKYARQLA
ANRGTILFVGTKRQSRDTIAQEAQRAGMPYVNARWLGGMLTNFKTLKVSIKRLKDMEAAL
EAGETERMSKKEALLFEREMAKLQKSIGGVKDMGGIPDAIFVVDVGYHKIAVTEANKLGV
PVIAVVDTNHSPEGIDYVIPGNDDASKAVALYAAGVADAILEGRANAVNEVVQAARGDDG
DEFVEVNAEA