Protein Info for H281DRAFT_00609 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00500: methionine aminopeptidase, type I" amino acids 3 to 253 (251 residues), 312.3 bits, see alignment E=1.2e-97 PF00557: Peptidase_M24" amino acids 13 to 246 (234 residues), 178.9 bits, see alignment E=5.8e-57

Best Hits

Swiss-Prot: 59% identical to MAP1_HAEIN: Methionine aminopeptidase (map) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 97% identity to bug:BC1001_2165)

MetaCyc: 58% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA65 at UniProt or InterPro

Protein Sequence (269 amino acids)

>H281DRAFT_00609 methionine aminopeptidase, type I (Paraburkholderia bryophila 376MFSha3.1)
MAITLKNEHDIAQMRVACKLASEVLDYITPFVTAGVTTGELDRLCHEYMLKEQGTVPAPL
NYQPPGYPPYPKATCISVNDVICHGIPGDKTLKNGDALNIDITVIKNGYFGDTSRMFIVG
EGSILAKRLVQTTFECMWLGIDQVRPGAHLGDIGYAIQKHAEAQGYSVVREYCGHGIGTV
FHEDPQILHYGRPGTGLELQAGMIFTIEPMINAGRRDIRTMPDQWTVKTKDRSLSAQWEH
TVLVTESGHDVLTVSAGTPARPPMVAATA