Protein Info for H281DRAFT_00606 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 23S rRNA pseudouridine2604 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01479: S4" amino acids 2 to 41 (40 residues), 35.3 bits, see alignment 7.9e-13 PF00849: PseudoU_synth_2" amino acids 57 to 207 (151 residues), 44.6 bits, see alignment E=1.8e-15 TIGR00093: pseudouridine synthase" amino acids 99 to 237 (139 residues), 110.3 bits, see alignment E=3.9e-36

Best Hits

KEGG orthology group: K06182, ribosomal large subunit pseudouridine synthase F [EC: 5.4.99.12] (inferred from 97% identity to bug:BC1001_2168)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>H281DRAFT_00606 23S rRNA pseudouridine2604 synthase (Paraburkholderia bryophila 376MFSha3.1)
MSELGLCSRREADEWIEKGWVLVDGERIDTLGTKVRPDQRVEIDPAAEAVQASQVTVLIH
KTVGYVSGQAEDGYQPAITLVTPENRWEGDRSDIRFSVAHLRQLAPAGRLDIDSTGLLVL
TQDGRIAKQLIGGHSDIDKEYLVRVAYGEHTVDVESHFPPESLALLCHGLSLDDVPLKPA
QVNWQNGEQLRFVLREGKKRQIRRMCELVGLEVLGLKRVRMGRVMLGALPPGQWRYLAAD
ESF