Protein Info for H281DRAFT_00573 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00583: Acetyltransf_1" amino acids 49 to 134 (86 residues), 55 bits, see alignment E=1.9e-18 PF13673: Acetyltransf_10" amino acids 55 to 141 (87 residues), 38.8 bits, see alignment E=1.7e-13 PF13508: Acetyltransf_7" amino acids 56 to 135 (80 residues), 44.6 bits, see alignment E=3.1e-15 PF13480: Acetyltransf_6" amino acids 58 to 117 (60 residues), 22.2 bits, see alignment E=2.7e-08

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_2202)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBY0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>H281DRAFT_00573 Predicted acetyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MFDPTEAPSSFHLRKASMDDFEFAEALTHSNMGGYYQRHHLVWRGDLFLGSWRESENFIL
EMDGKPIGVLRITQEGDSLHIRDVQIAEGYRRLGAGTYLLDMSHQWARERGLRELQLRVF
VDNPAARLYQRKGYKLAGPRLAQLGAIRHLARRV