Protein Info for H281DRAFT_00567 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutamyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00464: glutamate--tRNA ligase" amino acids 5 to 466 (462 residues), 543.2 bits, see alignment E=3e-167 PF00749: tRNA-synt_1c" amino acids 5 to 311 (307 residues), 324.7 bits, see alignment E=5e-101 PF19269: Anticodon_2" amino acids 325 to 468 (144 residues), 105.1 bits, see alignment E=4.3e-34

Best Hits

Swiss-Prot: 96% identical to SYE_PARPJ: Glutamate--tRNA ligase (gltX) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 96% identity to bpy:Bphyt_2495)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MC07 at UniProt or InterPro

Protein Sequence (469 amino acids)

>H281DRAFT_00567 glutamyl-tRNA synthetase (Paraburkholderia bryophila 376MFSha3.1)
MTTSVRTRFAPSPTGFIHLGNIRSALYPWAFARKMKGTFVLRIEDTDVERSTSESVDAIL
EGMEWLGLDFDEGPYYQMQRMDRYREVLKQMQDAGLVYPCYMSTEELDALRERQREAGEK
PRYDGTWRPEPGKVLPEPPAGVQPVLRFRNPLTGVVAWDDAVKGRIEISNEELDDLVIAR
PDGTPTYNFCVVVDDLDMRITHVIRGDDHVNNTPRQINILRALGGETPVYAHLPTVLNEQ
GEKMSKRHGAMSVMGYRDAGYLPEAVVNYLARLGWSHGDAEIFSREQFVEWFDLEHLGKS
PAQYDHDKLNWLNAHYIKEADNGRLAGLARPFLAELGIDEATIAQGADLTAVVGLLKDRA
STVKEIAENAAMFYRTPAPDADALAQHVTDAVRPALADLAAALKTVEWTKEAIAAALKTT
LGTHKLKMPQLAMPVRLLVAGTTHTPSIDMVLMLFGRDVVVGRIEKALA