Protein Info for H281DRAFT_00563 in Paraburkholderia bryophila 376MFSha3.1

Annotation: microcin C transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00005: ABC_tran" amino acids 43 to 200 (158 residues), 105.7 bits, see alignment E=1.7e-33 amino acids 324 to 476 (153 residues), 122.6 bits, see alignment E=9.5e-39 PF13304: AAA_21" amino acids 161 to 239 (79 residues), 29.1 bits, see alignment E=5.1e-10 PF08352: oligo_HPY" amino acids 255 to 281 (27 residues), 26.5 bits, see alignment (E = 3.3e-09) amino acids 527 to 551 (25 residues), 22.8 bits, see alignment (E = 4.8e-08)

Best Hits

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 90% identity to bgf:BC1003_1247)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH97 at UniProt or InterPro

Protein Sequence (554 amino acids)

>H281DRAFT_00563 microcin C transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
VTAQTQAPGQRKGRGDDGAEAPNAVPLLELDHLHVSFGDTVAVNDVTLAIQRGERVALVG
ESGSGKSVTALSILRLLSDAQVSGSIRFDGEDLLAKSEREMRGMRGSDIAMIFQEPMTAL
NPLYTVGAQIAETIVVHDGVSPAEARKRAVALLGRTGIPEPGKRVNSYPHQLSGGQRQRA
MIAMALACRPRLLLADEPTTALDVTIRAQIVELLLELQRDEAQKRGMAVLLITHDLNLVR
HFAQRIAVMEKGVLVESGPVEQVFESPQHPYTQRLLESRPQRSVVPVLPISPVLLQARDV
SVDFKTKVPGFAGWFRAGRFRAVANASVSVRQGETLGIVGESGSGKSTLAMALLGLQRTA
HGEIEFQGRALSTYRGAQQTALRSNMQVVFQDPFSSLSPRQTIERIVGEGLALHRPQMTP
QARRDRVVAVLREVGIDRTALLRYPHEFSGGQRQRIAIARALVVEPQILILDEPTSALDV
SIQQQVLKLLAGLQQKYNLGFVFISHDLAVIGAMAHRVAVMQNGSIVESGEVERIFATPE
HPYTRKLLKAALDR