Protein Info for H281DRAFT_00562 in Paraburkholderia bryophila 376MFSha3.1

Annotation: microcin C transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 280 to 305 (26 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 62 (39 residues), 30.3 bits, see alignment 3e-11 PF00528: BPD_transp_1" amino acids 175 to 359 (185 residues), 115.6 bits, see alignment E=2.4e-37

Best Hits

Swiss-Prot: 52% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 96% identity to bug:BC1001_2207)

MetaCyc: 52% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAX1 at UniProt or InterPro

Protein Sequence (368 amino acids)

>H281DRAFT_00562 microcin C transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MNRARLSADAAARVEPARAFVSPSPARRVWRRFRQQRLGYWSLIIFVVAFAASLAGPLWS
NDKPLVVRYDGHLYFPLFRTYAESTFGGDFPTPADYLDPYIKQRFDAPGNFAVYPPNHYY
YDTLNYFSKAPNPAPPSRENWLGTDDRGRDVFARLLYGFRVSVEFGLVLTFIGTILGIAA
GAVQGYFGGRTDIVGQRLIEIWSALPELYLLIIFSSIFEPGFILLIVLLSLFGWIGLSDY
VRAEFLRNRQQDYVRAARAMGLSNWQIMWRHLLPNSLTPVITFLPFRMSGAILALTSLDF
LGLGVPSPTPSLGELLAQGKANLDAWWISLSTFGVLVAMLLLLTFMGDALRNALDTRISD
AMRAGGNQ