Protein Info for H281DRAFT_00560 in Paraburkholderia bryophila 376MFSha3.1

Annotation: microcin C transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 38 to 54 (17 residues), see Phobius details PF00496: SBP_bac_5" amino acids 136 to 551 (416 residues), 241.7 bits, see alignment E=7.1e-76

Best Hits

KEGG orthology group: K13893, microcin C transport system substrate-binding protein (inferred from 94% identity to bgf:BC1003_1244)

Predicted SEED Role

"ABC transporter, periplasmic substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA25 at UniProt or InterPro

Protein Sequence (651 amino acids)

>H281DRAFT_00560 microcin C transport system substrate-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MTTGSRRVSSPRASECTFFRPSCVGPALASRSLRRARVAILCGALAAAGWFAAPEAHAVY
AIAQYGEPKYPADFKHFDYVNPDAPKGGTLVLANPSRLTSFDKFNPFTLRGNTAPGVDLL
FESLTTGSSDEVASAYGLLADDIKVAPDGLSTTFHINPRARFANGDPVTADDVKYSLDTL
KSPQAAPQFMSIFGQIVRAVVVDPHTVRFEFQHRNRELPLLAGGMPVFSRKWGMKPDGSH
IPFDQLAFEKPVTSGPYLIERYDNGRTITYRRNPEYWGAALPVRAGTYNFDRIVYKLYSD
NVARLEAFKAGEYDALVEYVARNWVRRDVGKKFDSGELIKKVFAQHNGTGMQGFMLNTRR
PLFKDVRVRKALDLALDFQWLNRQLFFNQYTRIDSFFANTDLQAKGLPSPGELALLEPWR
AKLDPAVFGPPPKQPDTDPPGSLRANLLQARALLQQAGWTYRDGALRNAKGEPFEFEILD
DSGSAAQMEPIVATFIRNLKKLGITATFRVADYAVYQKRLDAYDFDTTTIRMPDVQVPGS
EQIERFGSKAADTNGSDNMIGLKSPAVDAILRALVQAQTREQLLDATHALDRVLMHGYYV
VPHWYSATHRVAFKRGLAWPSTLPLYYGAEGWITSTWWFAQPQAATPAPPQ