Protein Info for H281DRAFT_00529 in Paraburkholderia bryophila 376MFSha3.1

Annotation: KUP system potassium uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 104 to 131 (28 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 290 to 316 (27 residues), see Phobius details amino acids 337 to 362 (26 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 428 to 446 (19 residues), see Phobius details PF02705: K_trans" amino acids 17 to 549 (533 residues), 725.2 bits, see alignment E=2.4e-222

Best Hits

Swiss-Prot: 96% identical to KUP_PARXL: Probable potassium transport system protein kup (kup) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 98% identity to bug:BC1001_2241)

MetaCyc: 50% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9C0 at UniProt or InterPro

Protein Sequence (628 amino acids)

>H281DRAFT_00529 KUP system potassium uptake protein (Paraburkholderia bryophila 376MFSha3.1)
MTDNNHVHKQPLPSLAVAAIGVVFGDIGTSPLYALKEAFSPSHGIPLTDQSILGVISLLF
WAIVIVVGIKYVLFVMRADNNGEGGVLALMALALRSLDEKSKMAGLLMMLGIFGACMFYG
DAVITPAISVISAVEGLEIAAPHLSHLVLPLTMVILVLLFWIQRHGTATVGRLFGPIMLV
WFVVLAALGLWHIVQSPNVIRALNPYYAYTFMAAHVLQAYVVLGSVVLVLTGAEALYADM
GHFGAKPIRMGWYVLVMPSLVLNYFGQGALLMHDAKAIENPFFLLAPQWALLPLVVLSTV
ATVIASQAVISGAYSLTSQAIQLGYVPRMKILHTSELAIGQIYVPVVNWMLLFIILCIVI
AFKSSDNLAAAYGIAVTATMVITTILACVVMVKVWNWNKFLVGLIIAVFITIDLGFFGAN
LLKVEEGGWLPLGIGALLFFLLMTWFKGRMIVKERTAADGIPLMPFLQGLLAHPPHRVSG
TAIYLTGSDSLVPVSLLHNLKHNKVLHERTIFLTFVTRDIPYVNDAERVTVKNIDGGLYL
VKAAYGFNETPDVKAVLTEIGRTHDMTFELMDTSFFLARETVVPTQLPGMSVWRERVFAW
MHQNAAKPTDFFSIPANRVVELGTKIEI