Protein Info for H281DRAFT_00528 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 24 to 169 (146 residues), 95.1 bits, E=1.4e-31

Best Hits

KEGG orthology group: K07101, (no description) (inferred from 98% identity to bxe:Bxe_A1607)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See A0A2Z5MA95 at UniProt or InterPro

Protein Sequence (196 amino acids)

>H281DRAFT_00528 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MVQGLPMIAMKDPRNDDKNLWVGWDEYHRLIELLAMAVHESGWKFDKILCLARGGLRVGD
QLSRIYDLPLAILATSSYREAAGTEQGELDIAQYITMTRGELHGNVLLVDDLVDSGVTLA
RVQQHLKERYPAITAVRSAVLWYKGCSKVKPDYHVQYLPTNPWIHQPFEEWDTVRPHNLG
AWIKRGVAQAQESSGN