Protein Info for H281DRAFT_00520 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 435 (433 residues), 565.7 bits, see alignment E=1.1e-173 TIGR00231: small GTP-binding protein domain" amino acids 4 to 157 (154 residues), 66.6 bits, see alignment E=3.4e-22 amino acids 179 to 337 (159 residues), 86.5 bits, see alignment E=2.7e-28 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 99.5 bits, see alignment E=5.9e-32 amino acids 181 to 299 (119 residues), 95.9 bits, see alignment E=7.6e-31 PF02421: FeoB_N" amino acids 5 to 136 (132 residues), 45.7 bits, see alignment E=2.4e-15 amino acids 181 to 342 (162 residues), 44.1 bits, see alignment E=7.3e-15 PF00009: GTP_EFTU" amino acids 181 to 348 (168 residues), 35.7 bits, see alignment E=3e-12 PF14714: KH_dom-like" amino acids 355 to 435 (81 residues), 92.8 bits, see alignment E=6e-30

Best Hits

Swiss-Prot: 99% identical to DER_PARXL: GTPase Der (der) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03977, GTP-binding protein (inferred from 99% identity to bgf:BC1003_1208)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBX2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>H281DRAFT_00520 GTP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRTGERPYLVVDTGGF
EPVAKDGILHEMARQTRQAVEESDIVVFIVDGRNGLAPQDKSIADYLRKTGRPIFLVVNK
AEGMKYSTVAADFYELGLGDPRAISAAHGDGVTEMINEALGVAYAGQPEESDDEKEARGV
KIAIVGRPNVGKSTLINALVGEERVIAFDMPGTTRDSIYVDFERQGKPYTLIDTAGLRRR
GKVFEAIEKFSVVKTLQSISDANVVILLLDARQDISEQDAHIAGFVVEQGRALVVGVNKW
DGLDSHVRERTKADLERKLKFLDFAKFHFISAAEKTGIGPLMRSVDDAYAAAMAKLPTPK
LTRALIDAVEFQQPRRRGPVRPKLRYAHQGGQNPPIIVIHGNALDAITETYKRYLENRFR
ETFKLTGTPLRIEFRSSTNPYADKG