Protein Info for H281DRAFT_00503 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Pimeloyl-ACP methyl ester carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00561: Abhydrolase_1" amino acids 27 to 280 (254 residues), 73.9 bits, see alignment E=2.5e-24 PF12146: Hydrolase_4" amino acids 28 to 127 (100 residues), 47.8 bits, see alignment E=1.8e-16 PF12697: Abhydrolase_6" amino acids 30 to 287 (258 residues), 60.2 bits, see alignment E=7.4e-20

Best Hits

KEGG orthology group: None (inferred from 94% identity to bgf:BC1003_1191)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA68 at UniProt or InterPro

Protein Sequence (294 amino acids)

>H281DRAFT_00503 Pimeloyl-ACP methyl ester carboxylesterase (Paraburkholderia bryophila 376MFSha3.1)
MNTSRSEFVAVRGVRLHVRRWGNPDAPALFMLHGWMDVAASFQFVVDAMGGDWQVIAPDM
RGFGLSDWPVAQSGGGHYWFHDYLADLDALLDHYAPTGQVNLVGHSLGANIVCLYAGVRP
ERVRRVVDLEGFGLAPSHAAQAPKRLQNWLDELRDPPQLKRYASLDEVAGRLVRTNPRLA
AARAQFLAKHWSKPDGEGRFMLLADPAHKLRGPTLYRLDEVMAVWRKVSAKVLHVEAAHS
PTLAAIAGEIPLDEFKARFQAFPDWREKIIDEAGHMVHHDQPEQVAALIEGFCA