Protein Info for H281DRAFT_00488 in Paraburkholderia bryophila 376MFSha3.1

Annotation: exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 186 to 204 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 23 to 564 (542 residues), 458.9 bits, see alignment E=9.5e-142 PF01368: DHH" amino acids 74 to 233 (160 residues), 85.7 bits, see alignment E=5e-28 PF02272: DHHA1" amino acids 323 to 451 (129 residues), 74 bits, see alignment E=2.6e-24 PF17768: RecJ_OB" amino acids 468 to 565 (98 residues), 70.5 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 96% identity to bug:BC1001_2282)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9Z0 at UniProt or InterPro

Protein Sequence (568 amino acids)

>H281DRAFT_00488 exonuclease RecJ (Paraburkholderia bryophila 376MFSha3.1)
MTRIVTRACSPVDAEILVRHGLHPVLARLYAARGVCLPDEIETGLARLVPPAALKGCEDA
AVLLADAIGQKRRMLVVADYDCDGATACAVAVRGLRMFGAQIDYLVPNRFEYGYGLTPEI
VALAARNASGKPDLLLTVDNGIASVDGVEAANALGIDVLVTDHHLPGDQLPAARAIVNPN
QPGCEFPSKCIAGVGVMFYVLLALRAELRRRGAFGDDFPEPRLDGLLDLVALGTVADVVK
LDGNNRVLVAQGLQRIRKGKMQPGIAALFRAAARDARSASGFDLGFALGPRLNAAGRLSD
MSLGIECLTTDDVGRAWELAQQLDAMNRERREIEAGMQQQALDDLSSIDPDGAATITLFN
PAWHQGVIGIVAGRLKEKFHRPSFTFALADDSGQLVKGSGRSIAGFHLRDALDLISKREP
GMIVKFGGHAMAAGLTLAAADVPRFTAAFEAVGREWLTEEALSRTVETDGELEDAYFTPQ
FVEMLDAAVWGQGFPAPVFSGEFDVASQALVKDKHLKLQLMRGRQRFNAIWFNHTDTLPA
RTTVAYRLASDTWNGVSRVQLIVEHAAS