Protein Info for H281DRAFT_00487 in Paraburkholderia bryophila 376MFSha3.1

Annotation: bacterial peptide chain release factor 2 (bRF-2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR00020: peptide chain release factor 2" amino acids 94 to 437 (344 residues), 509.8 bits, see alignment E=2e-157 PF03462: PCRF" amino acids 107 to 294 (188 residues), 184.3 bits, see alignment E=2.3e-58 PF00472: RF-1" amino acids 303 to 411 (109 residues), 147.1 bits, see alignment E=2e-47

Best Hits

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 95% identity to bpy:Bphyt_2570)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>H281DRAFT_00487 bacterial peptide chain release factor 2 (bRF-2) (Paraburkholderia bryophila 376MFSha3.1)
VERRLARAVDRRARGELERLHRRHRRRCANPPRRRKSPQNQSQTRAGSLDRLRRPAPIGY
NFPFLRSYKRSTWKRNVSTRSKPLWRTCASARPTYGGIFDYDDKALRLIEVNRELEDPDV
WNDSKHAQALGREKKLLDDTVGKLTSLDNDLRDAQDLFDMAREEGDDETLIACETDAQAL
EQRVADMEFRRMFANPADPNNAFLDIQAGAGGTEACDWASMLLRQYLRYCERKGFKTEVL
EQTDGDVAGIKNATIKIEGEYAYGFLRTETGVHRLVRKSPFDSSGGRHTSFSSVFVYPEV
DDSIEVDINPADLRIDTYRASGAGGQHINKTDSAVRITHIPSGIVVQCQNDRSQHRNRAE
AMAMLKSRLYEAEIRKRQAEQDKLEAGKTDVGWGHQIRSYVLDNSRIKDLRTNVEISNTK
SVLDGDLDPFISASLKQGV