Protein Info for H281DRAFT_00470 in Paraburkholderia bryophila 376MFSha3.1

Annotation: murein-DD-endopeptidase. Serine peptidase. MEROPS family S11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details PF00768: Peptidase_S11" amino acids 134 to 357 (224 residues), 194.5 bits, see alignment E=2.1e-61 PF13354: Beta-lactamase2" amino acids 143 to 301 (159 residues), 53 bits, see alignment E=3.2e-18

Best Hits

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 96% identity to bgf:BC1003_1158)

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-, 3.4.99.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9V3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>H281DRAFT_00470 murein-DD-endopeptidase. Serine peptidase. MEROPS family S11 (Paraburkholderia bryophila 376MFSha3.1)
MKTDMFSSLKVIHGAARSTALSVAASMVLAAALGAPVSTFAATPAASAKTSKHAKAATKP
AATAKVSSKSAKAGKAAVAKTAAVDDDAPRASVKRKRVTYTSNGRHRSVVRRVAYEPRQP
TVGQAFGLHETPDALMLRSSVAYVVDQNTGEPLFDKNSRAVVPIASITKLMTAMVVLDSK
EPMTDQLEVTDEDRDYEKNTGSRLSVGSVLSREDMLHIALMASENRAAAALSRYFPGGRP
AFLAAMNAKARQLGMTDTHFENPTGLTSQNVSSARDLVKMVNAAYQYPLIRRFSTDHSYE
VYTGKRTLAYNSTNALVRNPTWDIGLQKTGFINEAGECLVMQANIHGRPMVLVLLDSSGK
YSRFADATRLRTWLDNGGDQARITSADAGGPGT