Protein Info for H281DRAFT_00448 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 139 to 277 (139 residues), 104.7 bits, see alignment E=2.7e-34

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_2324)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA22 at UniProt or InterPro

Protein Sequence (331 amino acids)

>H281DRAFT_00448 Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily (Paraburkholderia bryophila 376MFSha3.1)
MFHLISSSLDSFVSALQTLLYVDVVQPLLFHFNLMDYDEDTYDSLYWVIVGVLEVLAMYA
ILRPLEALRPVEQWENRKAVRVDVIYTWIAKLGILNLFFFFALQPFFDHVQAWLRLHDIS
NIEFDNLWPGVTTQPLVTFVMYLLVLDFAGYWYHRWQHRVGVWWELHAVHHSQQQMSLWA
DDRNHLLDDLLQASFFAVIALVIGVPPSQFVVLVAITNLAQSVQHANIRLYFGWLGERLL
VSPTFHRRHHAIGYGHEGLKYGCNFGVLFPWWDMLFRSVSWSREMEPTGISDQLQGRVYG
EGFWAQHWLAFARIGRRLSARRRNQGGATAV