Protein Info for H281DRAFT_00437 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAS domain S-box-containing protein/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 781 PF13185: GAF_2" amino acids 59 to 204 (146 residues), 68.3 bits, see alignment E=2.5e-22 PF01590: GAF" amino acids 61 to 203 (143 residues), 55 bits, see alignment E=3.8e-18 TIGR00229: PAS domain S-box protein" amino acids 214 to 345 (132 residues), 26 bits, see alignment E=8.1e-10 PF00989: PAS" amino acids 218 to 322 (105 residues), 27.1 bits, see alignment E=1e-09 PF08448: PAS_4" amino acids 223 to 338 (116 residues), 24.6 bits, see alignment E=7.5e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 345 to 512 (168 residues), 137.8 bits, see alignment E=2.8e-44 PF00990: GGDEF" amino acids 349 to 510 (162 residues), 153.1 bits, see alignment E=1.7e-48 PF00563: EAL" amino acids 530 to 764 (235 residues), 248.2 bits, see alignment E=2.2e-77

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_2335)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9S4 at UniProt or InterPro

Protein Sequence (781 amino acids)

>H281DRAFT_00437 PAS domain S-box-containing protein/diguanylate cyclase (GGDEF) domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MRCLRFLADVGLGGAYMNREATSRMDVGATPDAGHYRPDLAEEVLASERSVLRLITRNTP
LPELLEEVCHRAEALLGGGASCSILLLDDDGVHVKMGAAPSLPAEFSTAIDGVPIGPSAG
SCGTAMYERRLVVVEDIETDSLWADFRALALPHGLRACWSVPFENDAGAVLGAFAVYHRE
PRRPTAQEETMLRDISRSVGLAVHQDAMAQRLANSEEHHRLVVDHLIEGIVVQSRSGVVL
ACNPSAQRMLRTGPQIVGRSIRTVMVRGFHEDGSPVAEHERPVAQVLASGKPMLGVTLAL
ELVNGEVIWVTENVVPILKPGESKPDSVLISFTDIGPVREAQRQLKFLATRDSLTGLYNR
AYLTERMNSLFAPGNPNYSGELTSVAVLFVDLDGFKKVNDTAGHEAGDALLKRVAERLAG
CVGPDDTLARVGGDEFVIVVSACECNEQIVGLARRILGEIAVPFAVADNEYYLGASIGIS
RFPEDGQDAPTLMRNADSAMYNAKQRGRNNFQFFTAELNQQLQRRFLIEQSLRRALAAHE
LSLVYQPIVDSHAGRTIGAEALLRWYNSELGNVSPAEFIPVAEDAGLIVEIGDWVLARAC
EQAAQWRRTLAPDLIVAVNLSPRQFNDGLVERIRRCLDHSGLEPAALELEITERLLMSDS
DTVLPMLLALSATGVRISVDDFGTGYSSLSYLKRFPLHNLKIDRSFVAGLPDHRDSIAIT
QAVVAMAHSLGMNVTAEGVETPEQAAFLRSIDCDKQQGYLYSRPVGASAYARALADVYAA
T