Protein Info for H281DRAFT_00435 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tRNA(Arg) A34 adenosine deaminase TadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 33 to 128 (96 residues), 53.3 bits, E=2.2e-18
• PF14437: MafB19-deam
  • amino acids 38 to 131 (94 residues), 40 bits, E=3.5e-14

Best Hits

Swiss-Prot: 32% identical to FCYS_SCHPO: Probable cytosine deaminase (SPCC965.14c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 90% identity to bpy:Bphyt_2635)

Predicted SEED Role

"Cytosine deaminase (EC 3.5.4.1)" (EC 3.5.4.1)

MetaCyc Pathways

• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage III (1/2 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.1

Use Curated BLAST to search for 3.5.4.1

Sequence Analysis Tools

See A0A2Z5M960 at UniProt or InterPro

Protein Sequence (185 amino acids)

>H281DRAFT_00435 tRNA(Arg) A34 adenosine deaminase TadA (Paraburkholderia bryophila 376MFSha3.1)
VSLTVPSAEMSATAGADAAGFPPQGLTPTHEQIVRHLRHSSRIAERATLLGHHPFGAVLV
GPDQETVLMEQGNVDTVNHAESVLARVAALNFTPAYLWSCTLYTSVEPCCMCAGTMYWAN
IGRVVFGMTEKRLLEATGDHAENPTMSVDCRYVFDHCQKRVEVIGPVAEVESEVMDVQRR
FWNSR