Protein Info for H281DRAFT_00427 in Paraburkholderia bryophila 376MFSha3.1

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 179 to 205 (27 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 274 to 308 (35 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 331 (275 residues), 157.5 bits, see alignment E=1.9e-50

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 96% identity to bgf:BC1003_1118)

Predicted SEED Role

"Possible fucose ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9R5 at UniProt or InterPro

Protein Sequence (341 amino acids)

>H281DRAFT_00427 monosaccharide ABC transporter membrane protein, CUT2 family (Paraburkholderia bryophila 376MFSha3.1)
MTMQPDSSALTGQRRLTGLRARIFSPTALQKLLAFASLILLLVFFSFASPAFMQMDNILG
ILQATAVNGVLAIASTFVIITGGIDLSVGTLMTFTAVICGVFLTYWHLPMWLGVIAAIGT
GAICGTISGTLTAKMKIPPFIATLGMMLLLKGLSLVVSADKPIYFTDTENFYMISQDSLI
GYLVPSLPIPNAVLILFFLAIVSSVTLNRTALGRYTFALGSNEEAVRLSGVNVDRWKIAI
YGLGGAICGIAGLLIASRLNSAQPALGQGYELEAIAAVVIGGTSLSGGSGTILGTIIGAF
IMSVLTNGLRIMSVAQEWQIVVTGLIIILAVYADILRRRKS