Protein Info for H281DRAFT_00417 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 58 to 84 (27 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 194 to 221 (28 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 262 (185 residues), 58.1 bits, see alignment E=5.1e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 97% identity to bgf:BC1003_1111)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBK7 at UniProt or InterPro

Protein Sequence (274 amino acids)

>H281DRAFT_00417 putative spermidine/putrescine transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
LNDITFPLRWRIALIAPALAVFIAFWLLPMGALAQLSGDGHAFATYRAMLTNPRYMSSLG
ATIVLSAAVTAATLVLSVIAGLLLARREFAFKRTLLALLTFPLAFPGVVVGFMVIMLAGR
QGLIGALSLKLTGDRWVFAYSMSGLFLGYLYFSIPRVIVTVMASATKLDASLEEAARSLG
ASPWRITRDIVLPALSPGLIAAGAVCFATAMGAFGTAFTLATDIDVLPMTIYTEFTLNAN
MMTAAGLSIVLGIVTWAVLALARSVSGSAVAASA