Protein Info for H281DRAFT_00399 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Thiosulfate reductase cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 22 to 211 (190 residues), 79.8 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 64% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 88% identity to bug:BC1001_2365)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9P6 at UniProt or InterPro

Protein Sequence (212 amino acids)

>H281DRAFT_00399 Thiosulfate reductase cytochrome b subunit (Paraburkholderia bryophila 376MFSha3.1)
MATPHVVRDSAPPAAPSSGVIHPVWVRITHWLNALAAIVMMLSGWRIYDASPVFPAFRFP
TEITLGGWLGGALQWHFAAMWLLVFNGLAYLALNLATGRFFRKFLPVSPRAVLHDFIAAL
TGKLSHADLRVYNAVQKFAYLFVVLDLLVLVLSGLAIWKSVQFPLLRELMGGYDNARIVH
FGAMALMAAFIVVHLAMVALVPRSLLAMLRGR