Protein Info for H281DRAFT_00380 in Paraburkholderia bryophila 376MFSha3.1

Annotation: nucleobase:cation symporter-1, NCS1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 470 to 489 (20 residues), see Phobius details TIGR00800: NCS1 nucleoside transporter family" amino acids 23 to 452 (430 residues), 377.3 bits, see alignment E=4.8e-117 PF02133: Transp_cyt_pur" amino acids 31 to 478 (448 residues), 380.8 bits, see alignment E=4.5e-118

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 96% identity to bxe:Bxe_A1430)

Predicted SEED Role

"Possible pyrimidine permease in reductive pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBI1 at UniProt or InterPro

Protein Sequence (503 amino acids)

>H281DRAFT_00380 nucleobase:cation symporter-1, NCS1 family (Paraburkholderia bryophila 376MFSha3.1)
MKQTAQPVDPQFAAGAQGSSLYNDDLAPTGPAQRTWRWYHFAALWVGMVMNIASYMLAAG
LTEEGMSPWQAVLTVLLGNLIVLVPMLLIGHAGAKHGIPYAVLVRSSFGTQGAKLPAMLR
AIVACGWYGIQTWLGGSAIYTLLNILTGNALHGAALPFIDISIAQLACFLVFWALQIYFI
VHGTDSIRWLESWSAPIKIVMCIALVWWATSKAGGLGSMLAAPSQFVPGGKKEGMFWATF
WPGLTAMVGFWATLALNIPDFTRFAKTQRDQIVGQSIGLPVPMALLSVISVVVTSATVVI
YGKAIWDPIDLTSRMTGIGVGLALIILTLDTMCCNLAANLVGPAYDFSSLWPKGISYRVG
GMITATIAIVMMPWKILATTQGYIFTWLVGYSALLGPVAGILMVDYFLIRGTRLDTRELF
DERGEYSYTGGWNIGAVVALVIGVLPNLPGFLHTAFPASFANVPSIFNTVYTYAWFVGLA
LASIVYSAWMKLSKGPSARVASA