Protein Info for H281DRAFT_00379 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dihydroorotate oxidase B, catalytic subunit /dihydrouracil dehydrogenase (NAD+) /dihydropyrimidine dehydrogenase (NADP+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF01180: DHO_dh" amino acids 4 to 305 (302 residues), 112.5 bits, see alignment E=9.2e-36 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 5 to 320 (316 residues), 176.6 bits, see alignment E=3.1e-56 PF01207: Dus" amino acids 122 to 180 (59 residues), 25 bits, see alignment E=4.1e-09 PF12837: Fer4_6" amino acids 338 to 362 (25 residues), 25.1 bits, see alignment (E = 5e-09) PF13237: Fer4_10" amino acids 338 to 391 (54 residues), 25.1 bits, see alignment 5.6e-09 PF14697: Fer4_21" amino acids 338 to 398 (61 residues), 81.6 bits, see alignment E=1.4e-26 PF12838: Fer4_7" amino acids 344 to 392 (49 residues), 34.3 bits, see alignment 1.1e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_2385)

MetaCyc: 60% identical to (NADP)-dependent dihydropyrimidine dehydrogenase (Brevibacillus agri)
Dihydropyrimidine dehydrogenase (NADP(+)). [EC: 1.3.1.2]; 1.3.1.2 [EC: 1.3.1.2]

Predicted SEED Role

"Dihydropyrimidine dehydrogenase [NADP+] (EC 1.3.1.2)" in subsystem Pyrimidine utilization (EC 1.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBH8 at UniProt or InterPro

Protein Sequence (442 amino acids)

>H281DRAFT_00379 dihydroorotate oxidase B, catalytic subunit /dihydrouracil dehydrogenase (NAD+) /dihydropyrimidine dehydrogenase (NADP+) (Paraburkholderia bryophila 376MFSha3.1)
MADLRCTIAGITSPNPFWLASAPPTDKAYNVNRAFEAGWGGVVWKTLGLDPHVVNVSSRY
GAVQWNGQRIAGLNNIELITDRPLDVNLREIAQVKRDWPERAMIVSLMVPCNERDWKWIL
PLVEDTGADAVELNFGCPHGMSERGMGAAVGQVPEYIEMVTRWVKESSKLPCLVKLTPNI
TDIRLGSRAAYKGGADGVSLINTINSIVAVDLDAMSPLPMVDGKGTHGGYCGPAVKPIAL
NMVAEIARDVETPNLPISGIGGISTWRDAAEFMVLGAGSVQVCTAAMHYGFRIVTDLADG
LANWMDEKGYATLDDIRGRAVPNVTDWKYLNLKYDIKARIDQDKCIQCGLCHIACEDTAH
QAIMKEKDGVRHFEVMDSECVGCNLCMHVCPVEQCITMERVDNGEYANWTTHPNNPARVN
APASEVEAESANAEPAHAAKAA