Protein Info for H281DRAFT_00376 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00440: TetR_N" amino acids 48 to 93 (46 residues), 45 bits, see alignment 7.3e-16 PF08362: TetR_C_3" amino acids 95 to 235 (141 residues), 177.3 bits, see alignment E=1.8e-56

Best Hits

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 94% identity to bpy:Bphyt_2692)

Predicted SEED Role

"Transcriptional regulator RutR of pyrimidine catabolism (TetR family)" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9W8 at UniProt or InterPro

Protein Sequence (246 amino acids)

>H281DRAFT_00376 transcriptional regulator, TetR family (Paraburkholderia bryophila 376MFSha3.1)
MKRDAAPMPPKANMRDDDVAGGITENDETRAPLRRRKAHIRESNEAHLLACAEAVFAERG
LDGASTAMIAERAGLPKANVHYYFPTKLALYRRVLEDLFEDWYRAADTFECSDDPVEAIG
GYVRAKMELSRRRPLGSKVWASEIIHGAGHMEDILTERVKPWLDSRVKVIDDWISRGLLA
PVDARTLMYMIWATTQHYADFDAQIRALKGKRAMTQKSFEATTEEVVQLVIRACGAVSPA
QRAPGR