Protein Info for H281DRAFT_00368 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Pimeloyl-ACP methyl ester carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 51 to 188 (138 residues), 48.8 bits, E=1.2e-16
• PF12697: Abhydrolase_6
  • amino acids 51 to 275 (225 residues), 56.2 bits, E=1.2e-18
• PF12146: Hydrolase_4
  • amino acids 79 to 171 (93 residues), 32.4 bits, E=9e-12

Best Hits

KEGG orthology group: None (inferred from 79% identity to bgf:BC1003_1062)

Predicted SEED Role

"benzoate degradation ring-cleavage hydrolase" in subsystem Benzoate transport and degradation cluster

Protein Sequence (284 amino acids)

>H281DRAFT_00368 Pimeloyl-ACP methyl ester carboxylesterase (Paraburkholderia bryophila 376MFSha3.1)
MQNAAVETPISHFADLPATASHGPLRIEYRWLNGAAAEPTGNATSHAPIAVFLHEGLGSI
AMWRDWPQSLCERLGMRGLVYSRPGYGLSTPRPHHVKWPVDFMSDQARDILPALLDELGI
GLQERRRMWVIGHSDGGSIALLYAALHPDALAGAVAIAPHVFVEELSVQSIAQTKQLYES
TDLRDKLARYHADVDSAFYGWNDIWLDPAFRDWSIAQQLSTISKPLLALQGHDDNYGTMA
QIDTIPEYAPHAELVKLDACGHSPHRDAPDRLNEAIAEFVSRHR