Protein Info for H281DRAFT_00361 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): (3S)-hydroxyadipyl-CoA dehydrogenase (EC 1.1.1.35) / enoyl-CoA hydratase domain
Rationale: H281DRAFT_00361 is specifically important for phenylacetate utilization via the oxygenase pathway. This pathway require a (3S)-hydroxyadipyl-CoA dehydrogenase (forming 3-oxoadipyl-CoA), which is probably provided by the aldehyde dehydrogenase domain of H281DRAFT_00361. H281DRAFT_00361 is 49% identical to PimB from Rhodopseudomonas palustris; the pim operon is involved in dicarboxylic fatty acid degradation (PMID:15758219), which is consistent with activity on (3S)-hydroxyadipyl-CoA. H281DRAFT_00361 also has an enoyl-CoA hydratase domain, whose role (if any) in phenylacetate utilization is not clear.
Original annotation: short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K07516, 3-hydroxyacyl-CoA dehydrogenase [EC: 1.1.1.35] (inferred from 93% identity to bug:BC1001_2403)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17) / Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC 5.3.3.8) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)" in subsystem Acetyl-CoA fermentation to Butyrate or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation or Butanol Biosynthesis (EC 1.1.1.35, EC 4.2.1.17, EC 5.1.2.3, EC 5.3.3.8)

MetaCyc Pathways

oleate β-oxidation (29/35 steps found)
phenylacetate degradation I (aerobic) (9/9 steps found)
adipate degradation (5/5 steps found)
superpathway of phenylethylamine degradation (9/11 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
fatty acid salvage (5/6 steps found)
1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
adipate biosynthesis (4/5 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
fatty acid β-oxidation III (unsaturated, odd number) (1/1 steps found)
benzoyl-CoA degradation I (aerobic) (5/7 steps found)
fatty acid β-oxidation I (generic) (5/7 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
L-isoleucine degradation I (4/6 steps found)
propanoate fermentation to 2-methylbutanoate (4/6 steps found)
pyruvate fermentation to butanol II (engineered) (4/6 steps found)
oleate β-oxidation (thioesterase-dependent, yeast) (1/2 steps found)
superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
valproate β-oxidation (6/9 steps found)
glycerol degradation to butanol (11/16 steps found)
(R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
glutaryl-CoA degradation (3/5 steps found)
L-valine degradation I (5/8 steps found)
pyruvate fermentation to hexanol (engineered) (7/11 steps found)
pyruvate fermentation to butanoate (4/7 steps found)
2-methyl-branched fatty acid β-oxidation (9/14 steps found)
oleate β-oxidation (reductase-dependent, yeast) (1/3 steps found)
6-gingerol analog biosynthesis (engineered) (3/6 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
fatty acid β-oxidation V (unsaturated, odd number, di-isomerase-dependent) (2/5 steps found)
pyruvate fermentation to butanol I (4/8 steps found)
oleate β-oxidation (isomerase-dependent, yeast) (1/4 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
3-phenylpropanoate degradation (5/10 steps found)
L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
gallate degradation III (anaerobic) (5/11 steps found)
9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
L-glutamate degradation VII (to butanoate) (5/12 steps found)
2-methylpropene degradation (2/8 steps found)
L-tryptophan degradation III (eukaryotic) (7/15 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
methyl tert-butyl ether degradation (3/10 steps found)
benzoate fermentation (to acetate and cyclohexane carboxylate) (6/17 steps found)
crotonate fermentation (to acetate and cyclohexane carboxylate) (5/16 steps found)
10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
toluene degradation VI (anaerobic) (4/18 steps found)
cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
androstenedione degradation I (aerobic) (8/25 steps found)
Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
superpathway of testosterone and androsterone degradation (8/28 steps found)
platensimycin biosynthesis (6/26 steps found)
cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
androstenedione degradation II (anaerobic) (6/27 steps found)
superpathway of cholesterol degradation I (cholesterol oxidase) (11/42 steps found)
superpathway of cholesterol degradation II (cholesterol dehydrogenase) (11/47 steps found)
superpathway of cholesterol degradation III (oxidase) (7/49 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35, 4.2.1.17, 5.1.2.3, 5.3.3.8

Use Curated BLAST to search for 1.1.1.35 or 4.2.1.17 or 5.1.2.3 or 5.3.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>H281DRAFT_00361 (3S)-hydroxyadipyl-CoA dehydrogenase (EC 1.1.1.35) / enoyl-CoA hydratase domain (Paraburkholderia bryophila 376MFSha3.1)
MSLTTSTDVVTRELRGKVLLVTIDHAPVNALSADVRRGLLAAIEAADSDPSVQAVLIVGA
GRNFIAGADIREFGKPPVPPSLPDVCNRIEACTKPVVAAIHGAALGGGLEVALAAHYRLA
VDGAKLGLPEVQLGLLPGAGGTQRTPRLIGAQAALDLMLSGRHANAQEALALGLVDRLGS
SDDILAEGLAYVHELLAGHAPVRRTRDATALNDRASSLAAVATARAETAKKSRGLFSPLK
IVDAVEAAIAQPFEDGLRRERQLFLECLDSPQRAGLVHAFFAEREVLKAPETRDTKPRAL
NAIGVVGGGTMGAGIAVAVLDAGLPVTMIERDEASLARGRAHIEKVYDGLIAKGRMSAEK
KAQLMARWTGSTSYDALADADLVIEAVFEDLSVKQAVFAELDRVCKPGAVLATNTSYLDI
DAIAASISRPADVIGLHFFSPANIMKLLEVVVPKAVSADVVATAFELAKKLRKTPVRAGV
CDGFIGNRILAVYRSAADAMMEDGASPYQIDAAVRAFGFPMGPFQVVDLAGGDIGWAARK
RRAATRNPAARYVQIADRLCERGWFGQKTGRGFYLYPEGSRSGQPDPEVEAIIDAERVRA
GITPREFSDDEIIRRYMAAMINEGANVVHERIALRPLDVDVTFLYGYGFPRYRGGPMKYA
DMIGLPRILADIREFAKEDPLFWRASPLLIDLVERGADFASLNHAA