Protein Info for H281DRAFT_00358 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 36 to 290 (255 residues), 161.4 bits, E=1.3e-51

Best Hits

Swiss-Prot: 42% identical to AK1A1_BOVIN: Aldo-keto reductase family 1 member A1 (AKR1A1) from Bos taurus

KEGG orthology group: None (inferred from 86% identity to bpy:Bphyt_1700)

MetaCyc: 42% identical to aldehyde reductase (Sus scrofa)
Indole-3-acetaldehyde reductase (NADPH). [EC: 1.1.1.191, 1.1.1.2]

Predicted SEED Role

"2,5-diketo-D-gluconic acid reductase (EC 1.1.1.-)" (EC 1.1.1.-)

MetaCyc Pathways

• glycerol degradation to butanol (11/16 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• D-xylose degradation to ethylene glycol (engineered) (1/4 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• detoxification of reactive carbonyls in chloroplasts (4/10 steps found)
• traumatin and (Z)-3-hexen-1-yl acetate biosynthesis (3/12 steps found)
• superpathway of lipoxygenase (4/22 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Caprolactam degradation
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.191 or 1.1.1.2

Protein Sequence (312 amino acids)

>H281DRAFT_00358 Aldo/keto reductase (Paraburkholderia bryophila 376MFSha3.1)
MIEPCDFRLKRIALNHGGGSMPAIGFGTLIADAAITISATKDALEAGYRHFDCAERYRNE
REVGDALQAGLAAGGIAREDIFVTTKLWNSNHRPERVKPAFDASLERLRLDYLDLYLIHT
PFAFQAGDEQDPRDANGNVLYDEGVTLLDTWRAMEDLVDGGRCRAIGLSDIGLDDLVPLY
ESARIKPAVVQVEAHPYLPESELLEFCKKKEIVFLAFAPLGHGIRPGPLEDPVVSRIAAR
IGKTPAQVLLAWAVQRGTAVLTTPKTAARARENFDISALPADAFDEINRIETRQRFNQVV
KTGNPGFIPRIE