Protein Info for H281DRAFT_00354 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, AraC family with amidase-like domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 1 to 173 (173 residues), 90.9 bits, see alignment E=1.3e-29 PF00165: HTH_AraC" amino acids 224 to 261 (38 residues), 30.8 bits, see alignment 3.6e-11 amino acids 276 to 313 (38 residues), 29.4 bits, see alignment 1e-10 PF12833: HTH_18" amino acids 235 to 314 (80 residues), 80.6 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 82% identity to bpy:Bphyt_2121)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>H281DRAFT_00354 transcriptional regulator, AraC family with amidase-like domain (Paraburkholderia bryophila 376MFSha3.1)
MKVAIVVFDGVQALDVAGPLDVFAEANANLSEHQRYEVSLVGSKAGTVTCSNGMQLSVPS
AFADSLAQFDMVLVAGGPTLPDYRPTDDFLKWLQTQAYGAARFGSVCNGAFVLGHAGLID
GKQVTTHWAEAARLARDFPLACVQPDRIFIRDGRLFTSAGVTAGIDLCLSLVAEDWGHEM
AVRVAKRLVVYIQREGGQSQYSPYIGAGKDDNPIIGKVHQYVTEHITDTLSIEQLATAVS
VSRRTFSRLFAKYAKVTPSAFVEQVRVDTARKLLEDSDAPLKTVAFKCGFHSATQMRTTF
ARRLNVTPKQYRQRFRGTVESRPRTDTGSGMLVAAQSASYS