Protein Info for H281DRAFT_00353 in Paraburkholderia bryophila 376MFSha3.1

Annotation: G/U mismatch-specific uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03167: UDG
  • amino acids 3 to 136 (134 residues), 56.2 bits, E=2.2e-19

Best Hits

Swiss-Prot: 48% identical to MUG_KLEP3: G/U mismatch-specific DNA glycosylase (mug) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03649, TDG/mug DNA glycosylase family protein [EC: 3.2.2.-] (inferred from 69% identity to bph:Bphy_5004)

MetaCyc: 45% identical to stationary phase mismatch/uracil DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-1922 [EC: 3.2.2.28]

Predicted SEED Role

"G:T/U mismatch-specific uracil/thymine DNA-glycosylase" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.28

Protein Sequence (148 amino acids)

>H281DRAFT_00353 G/U mismatch-specific uracil-DNA glycosylase (Paraburkholderia bryophila 376MFSha3.1)
MRAAATGHHFEGRNNRFWQTVHLAGFTPQQIRPEDDCTLLRYGCGLTTAVSRPTARAGEL
SRLEIEAAASDFQRKIAHYAPRYIAFLGKMAISAMSGTRDIQWGLQADRFGGARAWVLPN
PSGLNRAYSLDSLVSAYRELYVAVASSS