Protein Info for H281DRAFT_00340 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF13230: GATase_4" amino acids 28 to 270 (243 residues), 58.1 bits, see alignment E=6.9e-20 PF13522: GATase_6" amino acids 78 to 169 (92 residues), 35.8 bits, see alignment E=7.5e-13

Best Hits

KEGG orthology group: K07008, glutamine amidotransferase (inferred from 86% identity to bxe:Bxe_B1298)

Predicted SEED Role

"Glutamine amidotransferases class-II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAD8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>H281DRAFT_00340 glutamine amidotransferase (Paraburkholderia bryophila 376MFSha3.1)
MCRWLAYSGNPIQLETVMFNAKHSLIDQSLNSRLGHTTTNGDGFGIGWYGHPTDIPFRYR
CIQPAWSDRNLREAARAVRAPLFVAHIRAATDTPSQETNCHPFRHGRWLFAHNGLVRNYP
AVRRDLMIAISPELFPSIEGSTDSEVMFFLALTFGLELEPVTAIERMVGFVEETGRRHGV
AEPLNMTVCATDGEQIVAVRYSSERQSRSLFHNTSFRHLHQLYPDDTRIAMAGQDAFLVL
SEPLADLPGWWQEIPESTAVVARGGEIERFAFEPRGAAG