Protein Info for H281DRAFT_00339 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 68% identity to bge:BC1002_4743)

Predicted SEED Role

"Hypothetical membrane protein Rv2120c"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>H281DRAFT_00339 Uncharacterized membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MSMYVLALLIGVVAGLRTMTAPTAVSWAAYLGWLPLRETPLAFFGFAATPYIFMVLAIAE
FIVDQLPNTASRTVPIQFGARLVSGGLSGAAIGAAHGGWVGGVIAGLVGAVIGTLGGARA
RGAMSRAFGRDRPAALVEDAVAVVAAALIVMAVQ