Protein Info for H281DRAFT_00324 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 PF00989: PAS" amino acids 13 to 108 (96 residues), 37.5 bits, see alignment E=6.3e-13 TIGR00229: PAS domain S-box protein" amino acids 13 to 109 (97 residues), 38.8 bits, see alignment E=8.9e-14 PF08448: PAS_4" amino acids 16 to 107 (92 residues), 27.3 bits, see alignment E=1.1e-09 PF13426: PAS_9" amino acids 20 to 126 (107 residues), 40.6 bits, see alignment E=7.7e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 138 to 294 (157 residues), 70 bits, see alignment E=2e-23 PF00990: GGDEF" amino acids 139 to 289 (151 residues), 93.8 bits, see alignment E=3e-30 PF00563: EAL" amino acids 315 to 549 (235 residues), 261.6 bits, see alignment E=1.8e-81

Best Hits

KEGG orthology group: None (inferred from 86% identity to bug:BC1001_0983)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>H281DRAFT_00324 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (Paraburkholderia bryophila 376MFSha3.1)
MQDPSHPAVHARDAALEAAPFGMFICNARGTFEHVNAAFEKLTGMTANELVGRRSFESLH
DPAELARRRGELPILAKIGARYESEWTYLRRSGTPVRVVLALSPLSGEGVCHPGDARYVG
VVVDMTRYAQSDARLWYVSHHDGVTRLPNQTLFTERLELTIARCERHTSGFTVLIAELDH
LRKLRDALGLHAAELVLQIVGERLRGLFPNDGTIASIGGTQFALLINETGSAADAFAAEA
LSRIAEPIDYGGTALNIAASIGIVAYPDDGGDAPTLMRRAGVALSAAAAVNGNAVRRFST
ALEGQAARRFQIETMLREALERQQLHLVYQPQVTLATGRIAQVEALLRWNHPERGMISPA
EFVPVAEESGLIEQIGEWVIRTACRDAGKLLRMTGNLPRVAVNVSPQQFQRHDLFETIRG
ALDSAALAPSYLEVEITEGVLLGDTDQTLETLHALRGLGVEIAVDDFGTGYSSLAYLTRF
PLNRLKIDQSFVTRMAGDPQCHALVGAIVAMAHALGLRVTAEGVETPEQAAQLQALGCDE
AQGFWFSRPVTASALGNLLSPSGA