Protein Info for H281DRAFT_00318 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Glycosyltransferase involved in cell wall bisynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF20706: GT4-conflict" amino acids 169 to 390 (222 residues), 46.5 bits, see alignment E=5.2e-16 PF00534: Glycos_transf_1" amino acids 225 to 381 (157 residues), 124.8 bits, see alignment E=5.4e-40 PF13692: Glyco_trans_1_4" amino acids 228 to 367 (140 residues), 116 bits, see alignment E=3.3e-37 PF13524: Glyco_trans_1_2" amino acids 308 to 385 (78 residues), 36.5 bits, see alignment E=9.3e-13

Best Hits

KEGG orthology group: None (inferred from 83% identity to bxe:Bxe_A3286)

Predicted SEED Role

"Alpha-1,4-N-acetylgalactosamine transferase PglH (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>H281DRAFT_00318 Glycosyltransferase involved in cell wall bisynthesis (Paraburkholderia bryophila 376MFSha3.1)
MSETLKAAETDRAPLRILFHINDFGKGGTETALLSWLKTLDRRLFAPSLSVAYPTDDLAF
WRAHSIPDDVDVHVLASSEWMVALHKKARQRKLGLGEKLLHKALTYGAIRPLAARRMRRL
ASRHDLVCDFDFSLRHLAGSCGVPWIGVSHFSLAARLGNKSERYVARRVRHFARYSAVAV
LTPAMLREARELFATSHVDVTELPNVIDIDALRRAASGQIERPADSFIVSVARLDEGQKD
HKTLLRAYAQLRERGRCSAALVLIGEGRDRGELEQLARELGIAPSVHFLGFCANPSPYIR
QAELLVLSSRYEGFGMVLGEAMALGTPVLSTDCPTGPRDLLEGGKAGLLVPPGDVDAMAL
AMERLLTETELRRGLVQAASQKVASFAPASANQRMLALASRLLKEKAATSR