Protein Info for H281DRAFT_00315 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Glycosyltransferase involved in cell wall bisynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF13579: Glyco_trans_4_4" amino acids 15 to 163 (149 residues), 39.6 bits, see alignment E=1.8e-13 PF13439: Glyco_transf_4" amino acids 15 to 167 (153 residues), 83.1 bits, see alignment E=6.1e-27 PF00534: Glycos_transf_1" amino acids 180 to 318 (139 residues), 58.5 bits, see alignment E=1.6e-19 PF13692: Glyco_trans_1_4" amino acids 221 to 315 (95 residues), 47.6 bits, see alignment E=5.4e-16 PF20706: GT4-conflict" amino acids 243 to 298 (56 residues), 29.6 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 72% identical to Y986_BURTA: Probable transglycosylase BTH_I0986 (BTH_I0986) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: None (inferred from 85% identity to bpy:Bphyt_1256)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>H281DRAFT_00315 Glycosyltransferase involved in cell wall bisynthesis (Paraburkholderia bryophila 376MFSha3.1)
MMKLGLSSNALQHSGGLERYAMDLVRGFAARGVELAFFARRFDTSLPESGMVERHRINVS
FLPGKLRDRWFSWRLRSARRAAHVDLLIGCNRVDSSDIAICGGTHLGFLQATGRAQKHSD
HWQIELERRQYARSKVVVAHSQLMHDELRRLYEVDEAKIRVLYPPVDGTRFKPTDAATRA
ALRRKYGFADDEIVLLFPSSSHERKGLPLIEAALRDTSLPIVVAVAGRPPARTSERLRYI
GYVKELAECYQAADFTILASTYEPFGLVGIESVMCGTPVIFPSNIGCCDAIASHAKFVFE
PGDVADLRATLARVVAAHRDHARLAPPELTDAAAVRYDPSVAAHVDALLSLAKQIAPVS