Protein Info for H281DRAFT_00314 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP-binding cassette, subfamily B, MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 33 to 57 (25 residues), see Phobius details amino acids 77 to 103 (27 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details TIGR02203: lipid A export permease/ATP-binding protein MsbA" amino acids 23 to 594 (572 residues), 799.7 bits, see alignment E=7.5e-245 PF00664: ABC_membrane" amino acids 40 to 309 (270 residues), 153.8 bits, see alignment E=7.9e-49 PF00005: ABC_tran" amino acids 373 to 521 (149 residues), 117.8 bits, see alignment E=6e-38

Best Hits

Swiss-Prot: 92% identical to MSBA_PARXL: Lipid A export ATP-binding/permease protein MsbA (msbA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 96% identity to bug:BC1001_0967)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAT3 at UniProt or InterPro

Protein Sequence (597 amino acids)

>H281DRAFT_00314 ATP-binding cassette, subfamily B, MsbA (Paraburkholderia bryophila 376MFSha3.1)
LSAKPTLSKPIGEGEASSPAVVFRRLWPFIKPLLWVIVGAIVAMAVSAGTDAAIPALLKP
LLDKGFGAHASDNAKWFVPAAVIGLALIRGVSQYASGYLLAYVSNKILLELRLRMFDRMI
HTSVAFFQRETASTVINAIVFEVNQILNVLLGVMVTLVRDSLTVIFLLGYLFYLNWRLTL
IVAVLLPGIGWLVGKINRRLRRLNREHQLLTNELSYIVEETVGGYKVVKVHNGEKYEMDR
FTSMSKRLRGYAMRMTVSGGLAQPLTQFLASIALAVVITIAVVQSSSDQTTVGGFVAFVT
SMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPAEPAGGGKPLERARGEVEFRNVSF
MYSTNATHNRHTLDHVSFKVAPGEMVALAGPSGSGKTTLVNLLPRFFDPTGGEILVDGVP
IGDYDLHALRSQIAMVSQDVVLFNDTVANNVAYGQTADRDKVNAALRAANLWDTVEAMPN
GIDTLVGDNGMMLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMK
GRTTLVIAHRLSTIERANRILVMEAGRIAESGSHRELLAQNGLYAHLHRIQFQQSAA