Protein Info for H281DRAFT_00310 in Paraburkholderia bryophila 376MFSha3.1

Annotation: UPF0176 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF17773: UPF0176_N" amino acids 4 to 98 (95 residues), 90.9 bits, see alignment E=5.5e-30 PF00581: Rhodanese" amino acids 131 to 218 (88 residues), 28.9 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 93% identical to Y1152_PARXL: UPF0176 protein Bxeno_A1152 (Bxeno_A1152) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K07146, UPF0176 protein (inferred from 96% identity to bug:BC1001_0964)

Predicted SEED Role

"Rhodanese domain protein UPF0176, Betaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8V5 at UniProt or InterPro

Protein Sequence (287 amino acids)

>H281DRAFT_00310 UPF0176 protein (Paraburkholderia bryophila 376MFSha3.1)
MSIVNLAAYHFATIEDTAAWRPHVTERCNALGLRGTILLAPEGINLFVAGTRENTDAFVH
YIRHDPLFEGKFASLQFKESLSEKQPFTRMLVKLKREIITMKKPAIRPELGRAPFVDAPT
LKAWLDRGHDDEGRPVVMLDTRNAFEVDVGTFDNALDYRITKFSEFPEVIEQNRADLEGK
TVVSFCTGGIRCEKAAIHMKEVGIEHVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
PQLEPTATAQCFGCRAVVTPEAQKSPMYVPGKTCPACHPDSKAARAA