Protein Info for H281DRAFT_00309 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutamyl-Q tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 25 to 296 (272 residues), 395.7 bits, see alignment E=5.3e-123 PF00749: tRNA-synt_1c" amino acids 26 to 268 (243 residues), 142.4 bits, see alignment E=8.1e-46

Best Hits

Swiss-Prot: 78% identical to GLUQ_BURCJ: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 87% identity to bug:BC1001_0963)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>H281DRAFT_00309 glutamyl-Q tRNA(Asp) synthetase (Paraburkholderia bryophila 376MFSha3.1)
MSGMSSGQQGGSRCLNGGACRLMNYRGRFAPSPTGPLHFGSLVSALASWLDARAHHGAWL
VRIEDIDGPRTVPGAAQDILATLERFGMYADEPPVWQSTRIARYQQAFEQLKAAGLVYPC
GCTRKEIADSLLHAHTRNTTLAYPGTCRNGLHGKPARAWRLRVPDDDAAVIAFEDRWQGK
QTQNLATDVGDFVLRRADDQWAYQLAVVVDDADAGITHIVRGADLMDSTARQIYLQRCLG
VPTPRYLHVPVVTNQYGEKLSKQNGASALDCDQPLEALNAAARHLGLNLDSDASVKACTT
LDDFFTTATAAWAKRMRSAI