Protein Info for H281DRAFT_00282 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Protein of unknown function (DUF3311)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 transmembrane" amino acids 14 to 31 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details PF11755: DUF3311" amino acids 16 to 74 (59 residues), 84 bits, see alignment E=2.8e-28

Best Hits

KEGG orthology group: None (inferred from 92% identity to bxe:Bxe_A3322)

Predicted SEED Role

"COG5591: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9Q6 at UniProt or InterPro

Protein Sequence (79 amino acids)

>H281DRAFT_00282 Protein of unknown function (DUF3311) (Paraburkholderia bryophila 376MFSha3.1)
MAHDADANKASKHWLWLLLLPWIAMVWVPSYNKVEPVLFDFPFFYWYQLLWVLISAVITA
LVYMKTKARSSGRPQGDAQ